CRMP1 antibody (70R-5249)

Rabbit polyclonal CRMP1 antibody raised against the C terminal of CRMP1

Synonyms Polyclonal CRMP1 antibody, Anti-CRMP1 antibody, DRP-1 antibody, DRP1 antibody, DPYSL1 antibody, Collapsin Response Mediator Protein 1 antibody
Specificity CRMP1 antibody was raised against the C terminal of CRMP1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS
Assay Information CRMP1 Blocking Peptide, catalog no. 33R-8838, is also available for use as a blocking control in assays to test for specificity of this CRMP1 antibody


Western Blot analysis using CRMP1 antibody (70R-5249)

CRMP1 antibody (70R-5249) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRMP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRMP1 antibody (70R-5249) | CRMP1 antibody (70R-5249) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors