CRTAC1 antibody (70R-3987)

Rabbit polyclonal CRTAC1 antibody raised against the N terminal of CRTAC1

Synonyms Polyclonal CRTAC1 antibody, Anti-CRTAC1 antibody, CEP-68 antibody, ASPIC1 antibody, FLJ10320 antibody, Cartilage Acidic Protein 1 antibody
Specificity CRTAC1 antibody was raised against the N terminal of CRTAC1
Cross Reactivity Human
Applications WB
Immunogen CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK
Assay Information CRTAC1 Blocking Peptide, catalog no. 33R-3085, is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody

Images

Western Blot analysis using CRTAC1 antibody (70R-3987)

CRTAC1 antibody (70R-3987) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRTAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CRTAC1 antibody (70R-3987) | CRTAC1 antibody (70R-3987) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors