CRTAP antibody (70R-6983)

Rabbit polyclonal CRTAP antibody raised against the N terminal of CRTAP

Synonyms Polyclonal CRTAP antibody, Anti-CRTAP antibody, CASP antibody, LEPREL3 antibody, OI7 antibody, Cartilage Associated Protein antibody
Specificity CRTAP antibody was raised against the N terminal of CRTAP
Cross Reactivity Human
Applications WB
Immunogen CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF
Assay Information CRTAP Blocking Peptide, catalog no. 33R-8020, is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody


Western Blot analysis using CRTAP antibody (70R-6983)

CRTAP antibody (70R-6983) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRTAP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CRTAP antibody (70R-6983) | CRTAP antibody (70R-6983) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors