Cryptochrome 2 antibody (70R-4034)

Rabbit polyclonal Cryptochrome 2 antibody

Synonyms Polyclonal Cryptochrome 2 antibody, Anti-Cryptochrome 2 antibody, HCRY2 antibody, FLJ10332 antibody, CRY2 antibody, PHLL2 antibody, KIAA0658 antibody, Photolyase-Like antibody
Cross Reactivity Human
Applications WB
Immunogen Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
Assay Information Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody

Images

Western Blot analysis using Cryptochrome 2 antibody (70R-4034)

Cryptochrome 2 antibody (70R-4034) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRY2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cryptochrome 2 antibody (70R-4034) | Cryptochrome 2 antibody (70R-4034) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors