Crystallin Mu antibody (70R-1992)

Rabbit polyclonal Crystallin Mu antibody raised against the middle region of CRYM

Synonyms Polyclonal Crystallin Mu antibody, Anti-Crystallin Mu antibody, DFNA40 antibody, CRYM antibody, THBP antibody
Specificity Crystallin Mu antibody was raised against the middle region of CRYM
Cross Reactivity Human
Applications WB
Immunogen Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA
Assay Information Crystallin Mu Blocking Peptide, catalog no. 33R-1248, is also available for use as a blocking control in assays to test for specificity of this Crystallin Mu antibody

Images

Western Blot analysis using Crystallin Mu antibody (70R-1992)

Crystallin Mu antibody (70R-1992) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRYM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Crystallin Mu antibody (70R-1992) | Crystallin Mu antibody (70R-1992) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors