CSF1 antibody (70R-6241)

Rabbit polyclonal CSF1 antibody

Synonyms Polyclonal CSF1 antibody, Anti-CSF1 antibody, MCSF antibody, MGC31930 antibody, Macrophage Colony Stimulating Factor 1 antibody
Cross Reactivity Human
Applications WB
Immunogen CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
Assay Information CSF1 Blocking Peptide, catalog no. 33R-7283, is also available for use as a blocking control in assays to test for specificity of this CSF1 antibody

Images

Western Blot analysis using CSF1 antibody (70R-6241)

CSF1 antibody (70R-6241) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. CSF1 may be involved in development of the placenta.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CSF1 antibody (70R-6241) | CSF1 antibody (70R-6241) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors