CSGALNACT1 antibody (70R-6124)

Rabbit polyclonal CSGALNACT1 antibody raised against the N terminal Of Csgalnact1

Synonyms Polyclonal CSGALNACT1 antibody, Anti-CSGALNACT1 antibody, FLJ11264 antibody, beta4GalNAcT antibody
Specificity CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
Assay Information CSGALNACT1 Blocking Peptide, catalog no. 33R-4236, is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody

Images

Western Blot analysis using CSGALNACT1 antibody (70R-6124)

CSGALNACT1 antibody (70R-6124) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSGALNACT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CSGALNACT1 antibody (70R-6124) | CSGALNACT1 antibody (70R-6124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors