CSHL1 antibody (70R-6216)

Rabbit polyclonal CSHL1 antibody raised against the C terminal of CSHL1

Synonyms Polyclonal CSHL1 antibody, Anti-CSHL1 antibody, CSHP1 antibody, hCS-L antibody, MGC149868 antibody, CS-5 antibody, Chorionic Somatomammotropin Hormone-Like 1 antibody, CSL antibody
Specificity CSHL1 antibody was raised against the C terminal of CSHL1
Cross Reactivity Human
Applications WB
Immunogen CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV
Assay Information CSHL1 Blocking Peptide, catalog no. 33R-3515, is also available for use as a blocking control in assays to test for specificity of this CSHL1 antibody

Images

Western Blot analysis using CSHL1 antibody (70R-6216)

CSHL1 antibody (70R-6216) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSHL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CSHL1 antibody (70R-6216) | CSHL1 antibody (70R-6216) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors