CSK antibody (70R-3659)

Rabbit polyclonal CSK antibody raised against the middle region of CSK

Synonyms Polyclonal CSK antibody, Anti-CSK antibody, C-Src Tyrosine Kinase antibody, MGC117393 antibody
Specificity CSK antibody was raised against the middle region of CSK
Cross Reactivity Human
Applications WB
Immunogen CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF
Assay Information CSK Blocking Peptide, catalog no. 33R-8387, is also available for use as a blocking control in assays to test for specificity of this CSK antibody

Images

Western Blot analysis using CSK antibody (70R-3659)

CSK antibody (70R-3659) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSK specifically phosphorylates 'Tyr-504' on LCK, which acts as a negative regulatory site.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CSK antibody (70R-3659) | CSK antibody (70R-3659) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors