CSTF2 antibody (70R-4664)

Rabbit polyclonal CSTF2 antibody raised against the N terminal of CSTF2

Synonyms Polyclonal CSTF2 antibody, Anti-CSTF2 antibody, CstF-64 antibody, Cleavage Stimulation Factor 3' Pre-Rna Subunit 2 64Kda antibody
Specificity CSTF2 antibody was raised against the N terminal of CSTF2
Cross Reactivity Human
Applications WB
Immunogen CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
Assay Information CSTF2 Blocking Peptide, catalog no. 33R-9471, is also available for use as a blocking control in assays to test for specificity of this CSTF2 antibody


Western Blot analysis using CSTF2 antibody (70R-4664)

CSTF2 antibody (70R-4664) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSTF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CSTF2 antibody (70R-4664) | CSTF2 antibody (70R-4664) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors