CSTF3 antibody (70R-4882)

Rabbit polyclonal CSTF3 antibody raised against the N terminal of CSTF3

Synonyms Polyclonal CSTF3 antibody, Anti-CSTF3 antibody, Cleavage Stimulation Factor 3' Pre-Rna Subunit 3 77Kda antibody
Specificity CSTF3 antibody was raised against the N terminal of CSTF3
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE
Assay Information CSTF3 Blocking Peptide, catalog no. 33R-10133, is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody


Western Blot analysis using CSTF3 antibody (70R-4882)

CSTF3 antibody (70R-4882) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSTF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CSTF3 antibody (70R-4882) | CSTF3 antibody (70R-4882) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors