CTDSP2 antibody (70R-3879)

Rabbit polyclonal CTDSP2 antibody

Synonyms Polyclonal CTDSP2 antibody, Anti-CTDSP2 antibody, PSR2 antibody, Ctd antibody, Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 antibody, SCP2 antibody, OS4 antibody
Cross Reactivity Human
Applications WB
Immunogen CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV
Assay Information CTDSP2 Blocking Peptide, catalog no. 33R-5924, is also available for use as a blocking control in assays to test for specificity of this CTDSP2 antibody

Images

Western Blot analysis using CTDSP2 antibody (70R-3879)

CTDSP2 antibody (70R-3879) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTDSP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CTDSP2 antibody (70R-3879) | CTDSP2 antibody (70R-3879) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors