CTSG Blocking Peptide (33R-10411)

A synthetic peptide for use as a blocking control in assays to test for specificity of CTSG antibody, catalog no. 70R-10247

Synonyms CTSG control peptide, CTSG antibody Blocking Peptide, Anti-CTSG Blocking Peptide, cathepsin G Blocking Peptide, CG Blocking Peptide, MGC23078 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEV
Molecular Weight 27 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors