CTSL2 Blocking Peptide (33R-10331)

A synthetic peptide for use as a blocking control in assays to test for specificity of CTSL2 antibody, catalog no. 70R-10281

Synonyms CTSL2 control peptide, CTSL2 antibody Blocking Peptide, Anti-CTSL2 Blocking Peptide, cathepsin L2 Blocking Peptide, CATL2 Blocking Peptide, CTSU Blocking Peptide, CTSV Blocking Peptide, MGC125957 Blocking Peptide, CTSL2, CTSL-2, CTSL 2, CTSL-2 Blocking Peptide, CTSL 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAP
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may play an important role in corneal physiology. This gene is expressed in colorectal and breast carcinomas but not in normal colon, mammary gland, or peritumoral tissues, suggesting a possible role for this gene in tumor processes. Alternatively spliced variants, encoding the same protein, have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors