CUEDC1 antibody (70R-1277)

Rabbit polyclonal CUEDC1 antibody raised against the middle region of CUEDC1

Synonyms Polyclonal CUEDC1 antibody, Anti-CUEDC1 antibody, FLJ20739 antibody, DKFZp547L163 antibody, Cue Domain Containing 1 antibody
Specificity CUEDC1 antibody was raised against the middle region of CUEDC1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
Assay Information CUEDC1 Blocking Peptide, catalog no. 33R-8082, is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody


Western Blot analysis using CUEDC1 antibody (70R-1277)

CUEDC1 antibody (70R-1277) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CUEDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CUE protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CUEDC1 antibody (70R-1277) | CUEDC1 antibody (70R-1277) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors