CUTA antibody (70R-6437)

Rabbit polyclonal CUTA antibody

Synonyms Polyclonal CUTA antibody, Anti-CUTA antibody, Cuta Divalent Cation Tolerance Homolog antibody, MGC111154 antibody, C6orf82 antibody, ACHAP antibody
Cross Reactivity Human
Applications WB
Immunogen CUTA antibody was raised using a synthetic peptide corresponding to a region with amino acids AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL
Assay Information CUTA Blocking Peptide, catalog no. 33R-1183, is also available for use as a blocking control in assays to test for specificity of this CUTA antibody


Western Blot analysis using CUTA antibody (70R-6437)

CUTA antibody (70R-6437) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CUTA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CUTA antibody (70R-6437) | CUTA antibody (70R-6437) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors