CX36 antibody (70R-1689)

Rabbit polyclonal CX36 antibody raised against the middle region of Cx36

Synonyms Polyclonal CX36 antibody, Anti-CX36 antibody, CX36, CX 36, CX-36, CX 36 antibody, CX-36 antibody
Specificity CX36 antibody was raised against the middle region of Cx36
Cross Reactivity Human
Applications WB
Immunogen CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA
Assay Information CX36 Blocking Peptide, catalog no. 33R-6905, is also available for use as a blocking control in assays to test for specificity of this CX36 antibody


Western Blot analysis using CX36 antibody (70R-1689)

CX36 antibody (70R-1689) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CX36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJA9, also called connexin-36 (CX36), is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CX36 antibody (70R-1689) | CX36 antibody (70R-1689) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors