CXADR antibody (70R-6982)

Rabbit polyclonal CXADR antibody raised against the N terminal of CXADR

Synonyms Polyclonal CXADR antibody, Anti-CXADR antibody, CAR antibody, Coxsackie Virus And Adenovirus Receptor antibody, HCAR antibody
Specificity CXADR antibody was raised against the N terminal of CXADR
Cross Reactivity Human
Applications WB
Immunogen CXADR antibody was raised using the N terminal of CXADR corresponding to a region with amino acids ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK
Assay Information CXADR Blocking Peptide, catalog no. 33R-4065, is also available for use as a blocking control in assays to test for specificity of this CXADR antibody

Images

Western Blot analysis using CXADR antibody (70R-6982)

CXADR antibody (70R-6982) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXADR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CXADR antibody (70R-6982) | CXADR antibody (70R-6982) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors