CXCL1 protein (Mouse) (His tag) (80R-3439)

Purified recombinant CXCL1 protein (Mouse) (His tag)

Synonyms C X C motif chemokine 1 protein, Platelet derived growth factor inducible KC protein, Secretory N51 protein, Growth regulated alpha protein, CXCL 1 protein, CXCL-1 protein
Species Mouse
Protein Type Recombinant
Applications ELISA, SDS-PAGE, WB

Images

Western blot analysis using CXCL1 protein (Mouse) (His tag) (80R-3439)

Specifications

Residues MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKN GREACLDPEAPLVQKIVQKMLKGVPK
Expression System E.coli
Source His-fusion expressed in cell supernatent (soluble under denaturing conditions)
Purity > 90% pure
Molecular Weight 14 kDa
Tag/Conjugate His tag
Form & Buffer Supplied in liquid form in 6M guanidine hydrochloride and 20mM Tris buffer

Storage & Safety

Storage Store at 4 deg C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 deg C, avoid repeat freeze/thaw cycles

General Information

Biological Significance CXCL1 has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using CXCL1 protein (Mouse) (His tag) (80R-3439)

Availability: In stock

Price: $210.00
Size: 50 ug
OR
Shipping
View Our Distributors