CXCL16 antibody (70R-6007)

Rabbit polyclonal CXCL16 antibody

Synonyms Polyclonal CXCL16 antibody, Anti-CXCL16 antibody, CXCL16, SRPSOX antibody, CXCL-16 antibody, CXCL 16, C-X-C Motif Ligand 16 antibody, Chemokine antibody, CXCLG16 antibody, SR-PSOX antibody, CXCL-16, CXCL 16 antibody
Cross Reactivity Human
Applications WB
Immunogen CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV
Assay Information CXCL16 Blocking Peptide, catalog no. 33R-8984, is also available for use as a blocking control in assays to test for specificity of this CXCL16 antibody

Images

Western Blot analysis using CXCL16 antibody (70R-6007)

CXCL16 antibody (70R-6007) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXCL16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CXCL16 antibody (70R-6007) | CXCL16 antibody (70R-6007) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors