CXORF20 antibody (70R-4186)

Rabbit polyclonal CXORF20 antibody raised against the middle region of Cxorf20

Synonyms Polyclonal CXORF20 antibody, Anti-CXORF20 antibody, MGC33653 antibody, Chromosome X Open Reading Frame 20 antibody
Specificity CXORF20 antibody was raised against the middle region of Cxorf20
Cross Reactivity Human
Applications WB
Immunogen CXORF20 antibody was raised using the middle region of Cxorf20 corresponding to a region with amino acids DGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAW
Assay Information CXORF20 Blocking Peptide, catalog no. 33R-1949, is also available for use as a blocking control in assays to test for specificity of this CXORF20 antibody


Western Blot analysis using CXORF20 antibody (70R-4186)

CXORF20 antibody (70R-4186) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXORF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CXorf20 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CXORF20 antibody (70R-4186) | CXORF20 antibody (70R-4186) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors