CXORF26 antibody (70R-4351)

Rabbit polyclonal CXORF26 antibody raised against the middle region of Cxorf26

Synonyms Polyclonal CXORF26 antibody, Anti-CXORF26 antibody, MGC874 antibody, Chromosome X Open Reading Frame 26 antibody
Specificity CXORF26 antibody was raised against the middle region of Cxorf26
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNK
Assay Information CXORF26 Blocking Peptide, catalog no. 33R-4376, is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody


Western Blot analysis using CXORF26 antibody (70R-4351)

CXORF26 antibody (70R-4351) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXORF26 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CXORF26 antibody (70R-4351) | CXORF26 antibody (70R-4351) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors