CXorf66 antibody (70R-6484)

Rabbit polyclonal CXorf66 antibody raised against the middle region of CXorf66

Synonyms Polyclonal CXorf66 antibody, Anti-CXorf66 antibody, LOC347487 antibody, Chromosome X Open Reading Frame 66 antibody
Specificity CXorf66 antibody was raised against the middle region of CXorf66
Cross Reactivity Human
Applications WB
Immunogen CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE
Assay Information CXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody


Western Blot analysis using CXorf66 antibody (70R-6484)

CXorf66 antibody (70R-6484) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXorf66 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CXorf66 antibody (70R-6484) | CXorf66 antibody (70R-6484) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors