CYB561 antibody (70R-7533)

Rabbit polyclonal CYB561 antibody raised against the middle region of CYB561

Synonyms Polyclonal CYB561 antibody, Anti-CYB561 antibody, FRRS2 antibody, Cytochrome B-561 antibody
Specificity CYB561 antibody was raised against the middle region of CYB561
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA
Assay Information CYB561 Blocking Peptide, catalog no. 33R-4943, is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody


Western Blot analysis using CYB561 antibody (70R-7533)

CYB561 antibody (70R-7533) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYB561 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYB561 is a senescene-associated protein in normal human oral keratinocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYB561 antibody (70R-7533) | CYB561 antibody (70R-7533) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors