CYBA antibody (70R-6483)

Rabbit polyclonal CYBA antibody raised against the middle region of CYBA

Synonyms Polyclonal CYBA antibody, Anti-CYBA antibody, Cytochrome B-245 Alpha Polypeptide antibody
Specificity CYBA antibody was raised against the middle region of CYBA
Cross Reactivity Human
Applications WB
Immunogen CYBA antibody was raised using the middle region of CYBA corresponding to a region with amino acids TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP
Assay Information CYBA Blocking Peptide, catalog no. 33R-9120, is also available for use as a blocking control in assays to test for specificity of this CYBA antibody

Images

Western Blot analysis using CYBA antibody (70R-6483)

CYBA antibody (70R-6483) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYBA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYBA antibody (70R-6483) | CYBA antibody (70R-6483) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors