Cyclin M2 antibody (70R-6396)

Rabbit polyclonal Cyclin M2 antibody raised against the middle region of CNNM2

Synonyms Polyclonal Cyclin M2 antibody, Anti-Cyclin M2 antibody, Cyclin M 2, ACDP2 antibody, Cyclin M2, Cyclin M-2, Cyclin M-2 antibody, CNNM2 antibody, Cyclin M 2 antibody
Specificity Cyclin M2 antibody was raised against the middle region of CNNM2
Cross Reactivity Human
Applications WB
Immunogen Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
Assay Information Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody


Western Blot analysis using Cyclin M2 antibody (70R-6396)

Cyclin M2 antibody (70R-6396) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNNM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cyclin M2 antibody (70R-6396) | Cyclin M2 antibody (70R-6396) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors