Cyclin M4 antibody (70R-6323)

Rabbit polyclonal Cyclin M4 antibody raised against the middle region of CNNM4

Synonyms Polyclonal Cyclin M4 antibody, Anti-Cyclin M4 antibody, CNNM4 antibody, KIAA1592 antibody, Cyclin M4, Cyclin M 4 antibody, Cyclin M-4 antibody, Cyclin M-4, ACDP4 antibody, Cyclin M 4
Specificity Cyclin M4 antibody was raised against the middle region of CNNM4
Cross Reactivity Human,Mouse
Applications WB
Immunogen Cyclin M4 antibody was raised using the middle region of CNNM4 corresponding to a region with amino acids LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA
Assay Information Cyclin M4 Blocking Peptide, catalog no. 33R-5118, is also available for use as a blocking control in assays to test for specificity of this Cyclin M4 antibody

Images

Western Blot analysis using Cyclin M4 antibody (70R-6323)

Cyclin M4 antibody (70R-6323) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNNM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cyclin M4 antibody (70R-6323) | Cyclin M4 antibody (70R-6323) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors