Cyclin Y antibody (70R-5501)

Rabbit polyclonal Cyclin Y antibody raised against the middle region of CCNY

Synonyms Polyclonal Cyclin Y antibody, Anti-Cyclin Y antibody, C10orf9 antibody, CFP1 antibody, CBCP1 antibody, CCNY antibody
Specificity Cyclin Y antibody was raised against the middle region of CCNY
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
Assay Information Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody


Western Blot analysis using Cyclin Y antibody (70R-5501)

Cyclin Y antibody (70R-5501) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cyclin Y antibody (70R-5501) | Cyclin Y antibody (70R-5501) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors