CYP11B2 antibody (70R-3457)

Rabbit polyclonal CYP11B2 antibody raised against the middle region of CYP11B2

Synonyms Polyclonal CYP11B2 antibody, Anti-CYP11B2 antibody, CYPB2-11 antibody, CYP11B antibody, Cytochrome P450 Family 11 Subfamily B Polypeptide 2 antibody, CYPB2 11 antibody, ALDOS antibody, P450aldo antibody, CYPB2 11, CPN2 antibody, CYP11B2, P-450C18 antibody, CYPB2-11, CYP11BL antibody, P450C18 antibody
Specificity CYP11B2 antibody was raised against the middle region of CYP11B2
Cross Reactivity Human
Applications WB
Immunogen CYP11B2 antibody was raised using the middle region of CYP11B2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Assay Information CYP11B2 Blocking Peptide, catalog no. 33R-8145, is also available for use as a blocking control in assays to test for specificity of this CYP11B2 antibody

Images

Western Blot analysis using CYP11B2 antibody (70R-3457)

CYP11B2 antibody (70R-3457) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP11B2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP11B2 antibody (70R-3457) | CYP11B2 antibody (70R-3457) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors