CYP1A1 antibody (70R-7266)

Rabbit polyclonal CYP1A1 antibody raised against the middle region of CYP1A1

Synonyms Polyclonal CYP1A1 antibody, Anti-CYP1A1 antibody, P450DX antibody, CYPA-1 antibody, CP11 antibody, CYP1A1, CYP1 antibody, P1-450 antibody, AHH antibody, Cytochrome P450 Family 1 Subfamily A Polypeptide 1 antibody, AHRR antibody, CYPA 1, CYPA 1 antibody, P450-C antibody, CYPA-1
Specificity CYP1A1 antibody was raised against the middle region of CYP1A1
Cross Reactivity Human,Mouse
Applications WB
Immunogen CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Assay Information CYP1A1 Blocking Peptide, catalog no. 33R-7644, is also available for use as a blocking control in assays to test for specificity of this CYP1A1 antibody

Images

Western Blot analysis using CYP1A1 antibody (70R-7266)

CYP1A1 antibody (70R-7266) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP1A1 antibody (70R-7266) | CYP1A1 antibody (70R-7266) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors