CYP1B1 antibody (70R-5316)

Rabbit polyclonal CYP1B1 antibody raised against the middle region of CYP1B1

Synonyms Polyclonal CYP1B1 antibody, Anti-CYP1B1 antibody, CYPB 1 antibody, CYPB-1 antibody, Cytochrome P450 Family 1 Subfamily B Polypeptide 1 antibody, CYPB 1, CYP1B1, CP1B antibody, CYPB-1, GLC3A antibody
Specificity CYP1B1 antibody was raised against the middle region of CYP1B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CYP1B1 antibody was raised using the middle region of CYP1B1 corresponding to a region with amino acids AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
Assay Information CYP1B1 Blocking Peptide, catalog no. 33R-1584, is also available for use as a blocking control in assays to test for specificity of this CYP1B1 antibody

Images

Western Blot analysis using CYP1B1 antibody (70R-5316)

CYP1B1 antibody (70R-5316) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP1B1 antibody (70R-5316) | CYP1B1 antibody (70R-5316) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors