CYP20A1 antibody (70R-7506)

Rabbit polyclonal CYP20A1 antibody raised against the N terminal of CYP20A1

Synonyms Polyclonal CYP20A1 antibody, Anti-CYP20A1 antibody, CYPA1 20 antibody, MGC22229 antibody, Cytochrome P450 Family 20 Subfamily A Polypeptide 1 antibody, CYP20A1, CYPA1 20, CYP-M antibody, CYPA1-20 antibody, CYPA1-20
Specificity CYP20A1 antibody was raised against the N terminal of CYP20A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CYP20A1 antibody was raised using the N terminal of CYP20A1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV
Assay Information CYP20A1 Blocking Peptide, catalog no. 33R-4185, is also available for use as a blocking control in assays to test for specificity of this CYP20A1 antibody

Images

Western Blot analysis using CYP20A1 antibody (70R-7506)

CYP20A1 antibody (70R-7506) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP20A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP20A1 antibody (70R-7506) | CYP20A1 antibody (70R-7506) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors