CYP26B1 antibody (70R-3226)

Rabbit polyclonal CYP26B1 antibody raised against the N terminal of CYP26B1

Synonyms Polyclonal CYP26B1 antibody, Anti-CYP26B1 antibody, Cytochrome P450 Family 26 Subfamily B Polypeptide 1 antibody, CYPB1-26, CYP26A2 antibody, CYPB1-26 antibody, P450RAI-2 antibody, CYP26B1, MGC129613 antibody, CYPB1 26 antibody, DKFZp686G0638 antibody, CYPB1 26
Specificity CYP26B1 antibody was raised against the N terminal of CYP26B1
Cross Reactivity Human
Applications WB
Immunogen CYP26B1 antibody was raised using the N terminal of CYP26B1 corresponding to a region with amino acids LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF
Assay Information CYP26B1 Blocking Peptide, catalog no. 33R-5404, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody


Western Blot analysis using CYP26B1 antibody (70R-3226)

CYP26B1 antibody (70R-3226) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP26B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP26B1 antibody (70R-3226) | CYP26B1 antibody (70R-3226) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors