CYP27C1 antibody (70R-3462)

Rabbit polyclonal CYP27C1 antibody raised against the middle region of CYP27C1

Synonyms Polyclonal CYP27C1 antibody, Anti-CYP27C1 antibody, FLJ16008 antibody, CYPC1 27 antibody, CYP27C1, Cytochrome P450 Family 27 Subfamily C Polypeptide 1 antibody, CYPC1-27 antibody, CYPC1-27, CYPC1 27
Specificity CYP27C1 antibody was raised against the middle region of CYP27C1
Cross Reactivity Human
Applications WB
Immunogen CYP27C1 antibody was raised using the middle region of CYP27C1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
Assay Information CYP27C1 Blocking Peptide, catalog no. 33R-9856, is also available for use as a blocking control in assays to test for specificity of this CYP27C1 antibody


Western Blot analysis using CYP27C1 antibody (70R-3462)

CYP27C1 antibody (70R-3462) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP27C1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP27C1 antibody (70R-3462) | CYP27C1 antibody (70R-3462) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors