CYP2A7 antibody (70R-7501)

Rabbit polyclonal CYP2A7 antibody raised against the N terminal of CYP2A7

Synonyms Polyclonal CYP2A7 antibody, Anti-CYP2A7 antibody, CYP2A7, CYP2A antibody, CYPA7-2 antibody, CPA7 antibody, P450-IIA4 antibody, CPAD antibody, Cytochrome P450 Family 2 Subfamily A Polypeptide 7 antibody, CYPIIA7 antibody, CYPA7 2 antibody, CYPA7-2, CYPA7 2
Specificity CYP2A7 antibody was raised against the N terminal of CYP2A7
Cross Reactivity Human
Applications WB
Immunogen CYP2A7 antibody was raised using the N terminal of CYP2A7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN
Assay Information CYP2A7 Blocking Peptide, catalog no. 33R-6180, is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody

Images

Western Blot analysis using CYP2A7 antibody (70R-7501)

CYP2A7 antibody (70R-7501) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP2A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum; its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP2A7 antibody (70R-7501) | CYP2A7 antibody (70R-7501) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors