CYP2B6 antibody (70R-5412)

Rabbit polyclonal CYP2B6 antibody raised against the middle region of CYP2B6

Synonyms Polyclonal CYP2B6 antibody, Anti-CYP2B6 antibody, P450 antibody, CYPB6-2 antibody, CYPB6-2, CYP2B antibody, IIB1 antibody, CYP2B6, CYPIIB6 antibody, CPB6 antibody, Cytochrome P450 Family 2 Subfamily B Polypeptide 6 antibody, CYPB6 2, CYPB6 2 antibody
Specificity CYP2B6 antibody was raised against the middle region of CYP2B6
Cross Reactivity Human
Applications WB
Immunogen CYP2B6 antibody was raised using the middle region of CYP2B6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
Assay Information CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody


Western Blot analysis using CYP2B6 antibody (70R-5412)

CYP2B6 antibody (70R-5412) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP2B6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP2B6 antibody (70R-5412) | CYP2B6 antibody (70R-5412) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors