CYP2C19 antibody (70R-5326)

Rabbit polyclonal CYP2C19 antibody raised against the middle region of CYP2C19

Synonyms Polyclonal CYP2C19 antibody, Anti-CYP2C19 antibody, CYPC19 2 antibody, P450C2C antibody, P450IIC19 antibody, CYP2C antibody, CPCJ antibody, Cytochrome P450 Family 2 Subfamily C Polypeptide 19 antibody, CYPC19-2, CYP2C19, CYP 2C antibody, CYPC19-2 antibody, CYPC19 2
Specificity CYP2C19 antibody was raised against the middle region of CYP2C19
Cross Reactivity Human
Applications WB
Immunogen CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD
Assay Information CYP2C19 Blocking Peptide, catalog no. 33R-7517, is also available for use as a blocking control in assays to test for specificity of this CYP2C19 antibody

Images

Western Blot analysis using CYP2C19 antibody (70R-5326)

CYP2C19 antibody (70R-5326) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP2C19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP2C19 antibody (70R-5326) | CYP2C19 antibody (70R-5326) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors