CYP2C9 antibody (70R-5321)

Rabbit polyclonal CYP2C9 antibody raised against the C terminal of CYP2C9

Synonyms Polyclonal CYP2C9 antibody, Anti-CYP2C9 antibody, CYP2C antibody, CPC9 antibody, CYPC9-2, MGC88320 antibody, CYP2C9, CYPC9 2, CYPC9 2 antibody, CYPC9-2 antibody, P450IIC9 antibody, P450 MP-4 antibody, MGC149605 antibody, CYP2C10 antibody, P450 PB-1 antibody, Cytochrome P450 Family 2 Subfamily C Polypeptide 9 antibody
Specificity CYP2C9 antibody was raised against the C terminal of CYP2C9
Cross Reactivity Human
Applications WB
Immunogen CYP2C9 antibody was raised using the C terminal of CYP2C9 corresponding to a region with amino acids AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV
Assay Information CYP2C9 Blocking Peptide, catalog no. 33R-1211, is also available for use as a blocking control in assays to test for specificity of this CYP2C9 antibody

Images

Western Blot analysis using CYP2C9 antibody (70R-5321)

CYP2C9 antibody (70R-5321) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP2C9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP2C9 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by rifampin. The enzyme is known to metabolize many xenobiotics, including phenytoin, tolbutamide, ibuprofen and S-warfarin. Studies identifying individuals who are poor metabolizers of phenytoin and tolbutamide suggest that CYP2C9 gene is polymorphic.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP2C9 antibody (70R-5321) | CYP2C9 antibody (70R-5321) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors