CYP3A4 antibody (70R-7492)

Rabbit polyclonal CYP3A4 antibody raised against the middle region of CYP3A4

Synonyms Polyclonal CYP3A4 antibody, Anti-CYP3A4 antibody, CYP3A4, CYPA4 3, Cytochrome P450 Family 3 Subfamily A Polypeptide 4 antibody, HLP antibody, CYPA4-3, CP34 antibody, CYPA4-3 antibody, P450PCN1 antibody, CYPA4 3 antibody, CP33 antibody, MGC126680 antibody, P450C3 antibody, NF-25 antibody, CYP3A antibody, CYP3A3 antibody
Specificity CYP3A4 antibody was raised against the middle region of CYP3A4
Cross Reactivity Human
Applications WB
Immunogen CYP3A4 antibody was raised using the middle region of CYP3A4 corresponding to a region with amino acids MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG
Assay Information CYP3A4 Blocking Peptide, catalog no. 33R-6117, is also available for use as a blocking control in assays to test for specificity of this CYP3A4 antibody

Images

Western Blot analysis using CYP3A4 antibody (70R-7492)

CYP3A4 antibody (70R-7492) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP3A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs which are are used today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens.

References
Add a Paper

Ruurdtje Hoekstraa, Geert A.A. Nibourga, Tessa V. van der Hoevena, Mariëtte T. Ackermansc, Theodorus B.M. Hakvoortb, Thomas M. van Gulika, Wouter H. Lamersb, , Ronald P. Oude Elferinkb, Robert A.F.M. Chamuleau

The HepaRG cell line is suitable for bioartificial liver application

The International Journal of Biochemistry & Cell Biology

Volume: 43 Issue: 10 Page: 1483-1489 DOI: 10.1016/j.biocel.2011.06.011

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP3A4 antibody (70R-7492) | CYP3A4 antibody (70R-7492) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors