CYP3A43 antibody (70R-7258)

Rabbit polyclonal CYP3A43 antibody raised against the C terminal of CYP3A43

Synonyms Polyclonal CYP3A43 antibody, Anti-CYP3A43 antibody, CYPA4 3 antibody, CYPA4-3, CYPA4-3 antibody, MGC119316 antibody, CYP3A43, MGC119315 antibody, Cytochrome P450 Family 3 Subfamily A Polypeptide 43 antibody, CYPA4 3
Specificity CYP3A43 antibody was raised against the C terminal of CYP3A43
Cross Reactivity Human
Applications WB
Immunogen CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
Assay Information CYP3A43 Blocking Peptide, catalog no. 33R-4217, is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody

Images

Western Blot analysis using CYP3A43 antibody (70R-7258)

CYP3A43 antibody (70R-7258) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP3A43 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism.

References
Add a Paper

Ruurdtje Hoekstraa, Geert A.A. Nibourga, Tessa V. van der Hoevena, Mariëtte T. Ackermansc, Theodorus B.M. Hakvoortb, Thomas M. van Gulika, Wouter H. Lamersb, , Ronald P. Oude Elferinkb, Robert A.F.M. Chamuleau

The HepaRG cell line is suitable for bioartificial liver application

The International Journal of Biochemistry & Cell Biology

Volume: 43 Issue: 10 Page: 1483-1489 DOI: 10.1016/j.biocel.2011.06.011

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP3A43 antibody (70R-7258) | CYP3A43 antibody (70R-7258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors