CYP4A22 antibody (70R-6524)

Rabbit polyclonal CYP4A22 antibody raised against the N terminal of CYP4A22

Synonyms Polyclonal CYP4A22 antibody, Anti-CYP4A22 antibody, Cytochrome P450 Family 4 Subfamily A Polypeptide 22 antibody, CYPA22-4, CYPA22 4, CYP4A22, CYPA22-4 antibody, RP1-18D14.1 antibody, CYPA22 4 antibody
Specificity CYP4A22 antibody was raised against the N terminal of CYP4A22
Cross Reactivity Human
Applications IHC, WB
Immunogen CYP4A22 antibody was raised using the N terminal of CYP4A22 corresponding to a region with amino acids MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ
Assay Information CYP4A22 Blocking Peptide, catalog no. 33R-6526, is also available for use as a blocking control in assays to test for specificity of this CYP4A22 antibody

Images

Immunohistochemical staining using CYP4A22 antibody (70R-6524)

CYP4A22 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4A22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CYP4A22 antibody (70R-6524) | CYP4A22 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using CYP4A22 antibody (70R-6524) | CYP4A22 antibody (70R-6524) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors