CYP4B1 antibody (70R-7503)

Rabbit polyclonal CYP4B1 antibody raised against the N terminal of CYP4B1

Synonyms Polyclonal CYP4B1 antibody, Anti-CYP4B1 antibody, CYPB1-4, CYP4B1, CYPB1 4 antibody, Cytochrome P450 Family 4 Subfamily B Polypeptide 1 antibody, CYPB1 4, CYPB1-4 antibody, P-450HP antibody, CYPIVB1 antibody
Specificity CYP4B1 antibody was raised against the N terminal of CYP4B1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CYP4B1 antibody was raised using the N terminal of CYP4B1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW
Assay Information CYP4B1 Blocking Peptide, catalog no. 33R-8937, is also available for use as a blocking control in assays to test for specificity of this CYP4B1 antibody


Western Blot analysis using CYP4B1 antibody (70R-7503)

CYP4B1 antibody (70R-7503) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP4B1 antibody (70R-7503) | CYP4B1 antibody (70R-7503) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors