CYP4F12 antibody (70R-7260)

Rabbit polyclonal CYP4F12 antibody raised against the C terminal of CYP4F12

Synonyms Polyclonal CYP4F12 antibody, Anti-CYP4F12 antibody, CYPF12 4, CYPF12 4 antibody, CYPF12-4, CYP4F12, Cytochrome P450 Family 4 Subfamily F Polypeptide 12 antibody, F22329_1 antibody, CYPF12-4 antibody
Specificity CYP4F12 antibody was raised against the C terminal of CYP4F12
Cross Reactivity Human
Applications WB
Immunogen CYP4F12 antibody was raised using the C terminal of CYP4F12 corresponding to a region with amino acids TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV
Assay Information CYP4F12 Blocking Peptide, catalog no. 33R-9377, is also available for use as a blocking control in assays to test for specificity of this CYP4F12 antibody


Western Blot analysis using CYP4F12 antibody (70R-7260)

CYP4F12 antibody (70R-7260) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4F12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CYP4F12 antibody (70R-7260) | CYP4F12 antibody (70R-7260) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors