CYP4F3 antibody (70R-7504)

Rabbit polyclonal CYP4F3 antibody raised against the N terminal of CYP4F3

Synonyms Polyclonal CYP4F3 antibody, Anti-CYP4F3 antibody, LTB4H antibody, CYP4F3, Cytochrome P450 Family 4 Subfamily F Polypeptide 3 antibody, CYPF3-4, CYPF3-4 antibody, CYPF3 4, CYPF3 4 antibody, CPF3 antibody, CYP4F antibody
Specificity CYP4F3 antibody was raised against the N terminal of CYP4F3
Cross Reactivity Human
Applications WB
Immunogen CYP4F3 antibody was raised using the N terminal of CYP4F3 corresponding to a region with amino acids LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF
Assay Information CYP4F3 Blocking Peptide, catalog no. 33R-4812, is also available for use as a blocking control in assays to test for specificity of this CYP4F3 antibody

Images

Western Blot analysis using CYP4F3 antibody (70R-7504)

CYP4F3 antibody (70R-7504) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4F3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP4F3 antibody (70R-7504) | CYP4F3 antibody (70R-7504) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors