CYP4V2 antibody (70R-7012)

Rabbit polyclonal CYP4V2 antibody raised against the middle region of CYP4V2

Synonyms Polyclonal CYP4V2 antibody, Anti-CYP4V2 antibody, CYP4AH1 antibody, MGC43534 antibody, BCD antibody, CYP4V2, CYPV2 4, CYPV2-4, CYPV2 4 antibody, Cytochrome P450 Family 4 Subfamily V Polypeptide 2 antibody, CYPV2-4 antibody
Specificity CYP4V2 antibody was raised against the middle region of CYP4V2
Cross Reactivity Human
Applications WB
Immunogen CYP4V2 antibody was raised using the middle region of CYP4V2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI
Assay Information CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody

Images

Western Blot analysis using CYP4V2 antibody (70R-7012)

CYP4V2 antibody (70R-7012) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4V2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP4V2 antibody (70R-7012) | CYP4V2 antibody (70R-7012) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors