CYP4X1 antibody (70R-7249)

Rabbit polyclonal CYP4X1 antibody raised against the middle region of CYP4X1

Synonyms Polyclonal CYP4X1 antibody, Anti-CYP4X1 antibody, CYPX1-4, CYPX1 4, CYP4X1, Cytochrome P450 Family 4 Subfamily X Polypeptide 1 antibody, MGC40051 antibody, CYPX1 4 antibody, CYPX1-4 antibody
Specificity CYP4X1 antibody was raised against the middle region of CYP4X1
Cross Reactivity Human
Applications WB
Immunogen CYP4X1 antibody was raised using the middle region of CYP4X1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP
Assay Information CYP4X1 Blocking Peptide, catalog no. 33R-4850, is also available for use as a blocking control in assays to test for specificity of this CYP4X1 antibody

Images

Western Blot analysis using CYP4X1 antibody (70R-7249)

CYP4X1 antibody (70R-7249) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYP4X1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYP4X1 antibody (70R-7249) | CYP4X1 antibody (70R-7249) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors