Cystatin 8 antibody (70R-3907)

Rabbit polyclonal Cystatin 8 antibody

Synonyms Polyclonal Cystatin 8 antibody, Anti-Cystatin 8 antibody, Cystatin-Related Epididymal Specific antibody, Cystatin -8, CST8 antibody, Cystatin -8 antibody, Cystatin 8, Cystatin 8, Cystatin 8 antibody, CRES antibody
Cross Reactivity Human
Applications WB
Immunogen Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY
Assay Information Cystatin 8 Blocking Peptide, catalog no. 33R-5097, is also available for use as a blocking control in assays to test for specificity of this Cystatin 8 antibody


Western Blot analysis using Cystatin 8 antibody (70R-3907)

Cystatin 8 antibody (70R-3907) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CST8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Cystatin 8 antibody (70R-3907) | Cystatin 8 antibody (70R-3907) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors