CYTB antibody (70R-7028)

Rabbit polyclonal CYTB antibody raised against the N terminal of CYTB

Synonyms Polyclonal CYTB antibody, Anti-CYTB antibody, Cytochrome B antibody, MTCYB antibody
Specificity CYTB antibody was raised against the N terminal of CYTB
Cross Reactivity Human
Applications WB
Immunogen CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Assay Information CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody

Images

Western Blot analysis using CYTB antibody (70R-7028)

CYTB antibody (70R-7028) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CYTB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CYTB antibody (70R-7028) | CYTB antibody (70R-7028) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors