Cytokeratin 10 antibody (70R-2225)

Rabbit polyclonal Cytokeratin 10 antibody

Synonyms Polyclonal Cytokeratin 10 antibody, Anti-Cytokeratin 10 antibody, K10 antibody, Cytokeratin 10 antibody, Epidermolytic Hyperkeratosis antibody, Cytokeratin -10 antibody, Cytokeratin -10, KRT10 antibody, Cytokeratin 10, KPP antibody, Cytokeratin 10, Keratin 10 antibody, CK10 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Cytokeratin 10 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD
Assay Information Cytokeratin 10 Blocking Peptide, catalog no. 33R-2526, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 10 antibody

Images

Western Blot analysis using Cytokeratin 10 antibody (70R-2225)

Cytokeratin 10 antibody (70R-2225) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Cytokeratin 10 antibody (70R-2225) | Cytokeratin 10 antibody (70R-2225) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors