Cytokeratin 17 antibody (70R-3229)

Rabbit polyclonal Cytokeratin 17 antibody raised against the C terminal of KRT17

Synonyms Polyclonal Cytokeratin 17 antibody, Anti-Cytokeratin 17 antibody, PC antibody, Cytokeratin 17, Cytokeratin 17, K17 antibody, Keratin 17 antibody, PC2 antibody, KRT17 antibody, Cytokeratin -17, Cytokeratin -17 antibody, PCHC1 antibody, Cytokeratin 17 antibody
Specificity Cytokeratin 17 antibody was raised against the C terminal of KRT17
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen Cytokeratin 17 antibody was raised using the C terminal of KRT17 corresponding to a region with amino acids IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT
Assay Information Cytokeratin 17 Blocking Peptide, catalog no. 33R-3900, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 17 antibody

Images

Immunohistochemical staining using Cytokeratin 17 antibody (70R-3229)

Cytokeratin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KRT17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Cytokeratin 17 antibody (70R-3229) | Cytokeratin 17 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using Cytokeratin 17 antibody (70R-3229) | Cytokeratin 17 antibody (70R-3229) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors